Loading...
Statistics
Advertisement

Get Finance Tips and Advice from personal finance experts
www.financetips247.com/
We provide all information about Investing, real estate, Loans, Personal Finance, Credit, Debt

Financetips247.com

Advertisement
Conversion Technology Metas Server
Financetips247.com is hosted in United States / Dallas . Financetips247.com uses HTTPS protocol. Number of used technologies: 8. First technologies: Carousel, CSS, Html, Number of used javascripts: 9. First javascripts: Jquery.js, Jquery-migrate.min.js, Adsbygoogle.js, Number of used analytics tools: 2. First analytics tools: Google Analytics, Histats, Number of used plugins, modules: 3. Its server type is: LiteSpeed. Its CMS is: Wordpress.

Technologies in use by Financetips247.com

Technology

Number of occurences: 8
  • Carousel
  • CSS
  • Html
  • Html5
  • Javascript
  • jQuery
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 9
  • jquery.js
  • jquery-migrate.min.js
  • adsbygoogle.js
  • show_ads.js
  • jquery.form.min.js
  • scripts.js
  • customscript.js
  • wp-tab-widget.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 2
  • Google Analytics
  • Histats

Advertise

Number of occurences: 1
  • Google Adsense

Server Type

  • LiteSpeed

Powered by

  • PHP/5.5.34

Used plugins, modules

Number of plugins and modules: 3
  • contact form 7
  • wp tab widget
  • add to any

Google Analytics ID

  • UA-68083196-8

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Financetips247.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=EssentialSSL/CN=www.gravity-lifestyle.com
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: EssentialSSL
      • CN: www.gravity-lifestyle.com
    • hash: cce1a118
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 61754315181986660124359065525024834507
    • validFrom: 150804000000Z
    • validTo: 160803235959Z
    • validFrom_time_t: 1438646400
    • validTo_time_t: 1470268799
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: 54:49:C4:F1:CB:D7:B7:C0:94:65:16:06:57:9E:B6:AC:1A:57:B1:BB
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:www.gravity-lifestyle.com, DNS:gravity-lifestyle.com

Meta - Financetips247.com

Number of occurences: 7
  • Name:
    Content:
  • Name: viewport
    Content: width=device-width, initial-scale=1, maximum-scale=1
  • Name: apple-mobile-web-app-capable
    Content: yes
  • Name: apple-mobile-web-app-status-bar-style
    Content: black
  • Name: generator
    Content: WordPress 4.1.10
  • Name: description
    Content: We provide all information about Investing, real estate, Loans, Personal Finance, Credit, Debt
  • Name: keywords
    Content: Investing, real estate, personal loans, personal finance, credit card debt

Server / Hosting

  • IP: 198.252.99.172
  • Latitude: 32.81
  • Longitude: -96.87
  • Country: United States
  • City: Dallas

Rname

  • ns6.hawkhost.com
  • ns5.hawkhost.com
  • financetips247.com

Target

  • server.hawkhost.com

HTTP Header Response

HTTP/1.1 200 OK X-Powered-By: PHP/5.5.34 X-Pingback: http://financetips247.com/xmlrpc.php Content-Type: text/html; charset=UTF-8 Date: Wed, 27 Apr 2016 14:22:52 GMT Accept-Ranges: bytes Server: LiteSpeed Connection: close

DNS

host: financetips247.com
  1. class: IN
  2. ttl: 86399
  3. type: A
  4. ip: 198.252.99.172
host: financetips247.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns6.hawkhost.com
host: financetips247.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns5.hawkhost.com
host: financetips247.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns5.hawkhost.com
  5. rname: server.hawkhost.com
  6. serial: 2015112516
  7. refresh: 86400
  8. retry: 7200
  9. expire: 2419200
  10. minimum-ttl: 86400
host: financetips247.com
  1. class: IN
  2. ttl: 86400
  3. type: MX
  4. pri: 0
  5. target: financetips247.com
host: financetips247.com
  1. class: IN
  2. ttl: 86400
  3. type: TXT
  4. txt: v=spf1 +a +mx +ip4:72.29.127.19 +include:_spf.arandomserver.com ~all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.inancetips247.com, www.fqinancetips247.com, www.qinancetips247.com, www.financetips247.com, www.inancetips247.com, www.fainancetips247.com, www.ainancetips247.com, www.fyinancetips247.com, www.yinancetips247.com, www.ftinancetips247.com, www.tinancetips247.com, www.fginancetips247.com, www.ginancetips247.com, www.fbinancetips247.com, www.binancetips247.com, www.fwinancetips247.com, www.winancetips247.com, www.fsinancetips247.com, www.sinancetips247.com, www.fdinancetips247.com, www.dinancetips247.com, www.frinancetips247.com, www.rinancetips247.com, www.f3inancetips247.com, www.3inancetips247.com, www.f4inancetips247.com, www.4inancetips247.com, www.fnancetips247.com, www.firnancetips247.com, www.frnancetips247.com, www.fifnancetips247.com, www.ffnancetips247.com, www.fivnancetips247.com, www.fvnancetips247.com, www.fiknancetips247.com, www.fknancetips247.com, www.fi,nancetips247.com, www.f,nancetips247.com, www.fibnancetips247.com, www.fbnancetips247.com, www.fignancetips247.com, www.fgnancetips247.com, www.fitnancetips247.com, www.ftnancetips247.com, www.fiynancetips247.com, www.fynancetips247.com, www.fiunancetips247.com, www.funancetips247.com, www.fijnancetips247.com, www.fjnancetips247.com, www.fimnancetips247.com, www.fmnancetips247.com, www.finnancetips247.com, www.fnnancetips247.com, www.fiancetips247.com, www.finnancetips247.com, www.financetips247.com, www.finhancetips247.com, www.fihancetips247.com, www.finjancetips247.com, www.fijancetips247.com, www.finkancetips247.com, www.fikancetips247.com, www.finlancetips247.com, www.filancetips247.com, www.fin ancetips247.com, www.fi ancetips247.com, www.finncetips247.com, www.finaoncetips247.com, www.finoncetips247.com, www.finapncetips247.com, www.finpncetips247.com, www.fina9ncetips247.com, www.fin9ncetips247.com, www.financetips247.com, www.finncetips247.com, www.finaincetips247.com, www.finincetips247.com, www.finauncetips247.com, www.finuncetips247.com, www.finacetips247.com, www.finanncetips247.com, www.financetips247.com, www.finanhcetips247.com, www.finahcetips247.com, www.finanjcetips247.com, www.finajcetips247.com, www.finankcetips247.com, www.finakcetips247.com, www.finanlcetips247.com, www.finalcetips247.com, www.finan cetips247.com, www.fina cetips247.com, www.finanetips247.com, www.financdetips247.com, www.finandetips247.com, www.financretips247.com, www.finanretips247.com, www.financtetips247.com, www.finantetips247.com, www.financvetips247.com, www.finanvetips247.com, www.financfetips247.com, www.finanfetips247.com, www.financgetips247.com, www.finangetips247.com, www.financhetips247.com, www.finanhetips247.com, www.financnetips247.com, www.finannetips247.com, www.financmetips247.com, www.finanmetips247.com, www.financjetips247.com, www.finanjetips247.com, www.financtips247.com, www.financextips247.com, www.financxtips247.com, www.financestips247.com, www.financstips247.com, www.financewtips247.com, www.financwtips247.com, www.financertips247.com, www.financrtips247.com, www.financeftips247.com, www.financftips247.com, www.financevtips247.com, www.financvtips247.com, www.financectips247.com, www.financctips247.com, www.financeqtips247.com, www.financqtips247.com, www.financeatips247.com, www.financatips247.com, www.financeytips247.com, www.financytips247.com, www.financeips247.com, www.financetqips247.com, www.financeqips247.com, www.financetaips247.com, www.financeaips247.com, www.financet ips247.com, www.finance ips247.com, www.financetwips247.com, www.financewips247.com, www.financeteips247.com, www.financeeips247.com, www.financetzips247.com, www.financezips247.com, www.financetxips247.com, www.financexips247.com, www.financetcips247.com, www.financecips247.com, www.financetps247.com, www.financetirps247.com, www.financetrps247.com, www.financetifps247.com, www.financetfps247.com, www.financetivps247.com, www.financetvps247.com, www.financetikps247.com, www.financetkps247.com, www.financeti,ps247.com, www.financet,ps247.com, www.financetibps247.com, www.financetbps247.com, www.financetigps247.com, www.financetgps247.com, www.financetitps247.com, www.financettps247.com, www.financetiyps247.com, www.financetyps247.com, www.financetiups247.com, www.financetups247.com, www.financetijps247.com, www.financetjps247.com, www.financetimps247.com, www.financetmps247.com, www.financetinps247.com, www.financetnps247.com,

Other websites we recently analyzed

  1. gtib.cn.com
    China - 103.232.215.150
    Server software: Tengine/1.4.2
    Technology: Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  2. medicalmalpracticelawyerpennsylvania.com
    Houston (United States) - 108.167.131.22
    Server software: Apache/2.2.27 (Unix) mod_ssl/2.2.27 OpenSSL/1.0.1e-fips DAV/2 mod_bwlimited/1.4
    Technology: Html
    Number of meta tags: 1
  3. EQ Logik - Sönke Wulff
    Germany - 213.203.239.230
    Server software: Apache/2.0.55 (Debian) FrontPage/5.0.2.2635 PHP/4.4.2-1+b1 mod_ssl/2.0.55 OpenSSL/0.9.8c
    Technology: Html
    Number of meta tags: 1
  4. Fasching-Karneval-Shop
    Spezialist für Karneval, Fasching, Halloween Oktoberfest Weihnachten, Nikolaus, Ostern, 60er Jahre, 70er Jahre, 80er Jahre, Mottopartys, Themenpartys, Karnevalskostüme, Faschingskostüme, Perücken, Brillen, Bärte, Jungesellenabschied und Zubehör
    Germany - 62.104.45.105
    Server software: Apache
    Technology: CSS, Html, Javascript, jQuery UI
    Number of Javascript: 11
    Number of meta tags: 5
  5. Hoststar - Webspace und Hosting mit vielen Vorteilen - Top Webhosting zum sensationellen Preis
    Wir bieten Ihnen Webhosting, Reseller-Hosting, Domains und vServer für Ihren Internetauftritt bereits ab CHF 5.90 pro Monat.
    Germany - 5.9.101.76
    Server software: Apache
    Technology: CSS, Html, Html5, SVG
    Number of meta tags: 3
  6. Harry Sturm & Associates Inc
    Check out this GoDaddy hosted webpage! http://hsa-recruiting.com.
    Scottsdale (United States) - 97.74.42.79
    Server software: Microsoft-IIS/7.0
    Technology: CSS, Html, Javascript, jQuery, jQuery UI
    Number of Javascript: 4
    Number of meta tags: 3
  7. AAU Golf > Home
    United States - 12.179.190.211
    Server software: Redirector/1.0
    Technology: CSS, Html, Javascript, jQuery, jQuery Hover Intent, jQuery UI, comScore, Google Analytics, Google Publisher Tag, DotNetNuke
    Number of Javascript: 12
    Number of meta tags: 7
  8. jelenka.eu - Na úvod
    Czech Republic - 89.185.253.48
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, jQuery, jQuery Cycle, Php, Swf Object
    Number of Javascript: 11
    Number of meta tags: 3
  9. Hi-Tact – Singapore's Scaffolding Solutions
    Singapore - 103.11.189.21
    Server software: Apache
    Technology: CloudFlare, CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Revslider, SVG, Wordpress
    Number of Javascript: 12
    Number of meta tags: 3
  10. Lynchburg & Roanoke Hyundai Provider | Robert Woodall Hyundai in Danville
    Make Robert Woodall Hyundai in Danville your Lynchburg and Roanoke source for new and used cars, OEM parts, service & financing!
    Europe - 2.20.189.9
    Server software: squid/3.5.14
    Technology: CSS, Flexslider, Html, Javascript, SVG
    Number of Javascript: 6
    Number of meta tags: 6

Check Other Websites